Mycolicibacterium aurum: NCTC10437_02406 Help Entry NCTC10437_02406   CDS       T06794                                  Name (GenBank) Uncharacterised protein   KO K00230   menaquinone-dependent protoporphyrinogen oxidase [EC:1.3.5.3] Organism mauu  Mycolicibacterium aurum Pathway mauu00860   Porphyrin metabolism mauu01100   Metabolic pathways mauu01110   Biosynthesis of secondary metabolites mauu01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:mauu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     NCTC10437_02406 Enzymes [BR:mauu01000]  1. Oxidoreductases   1.3  Acting on the CH-CH group of donors    1.3.5  With a quinone or related compound as acceptor     1.3.5.3  protoporphyrinogen IX dehydrogenase (quinone)      NCTC10437_02406 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  VEG54311 UniProt:  A0A3S4VLY8 LinkDB All DBs Position 1:2487517..2487780 Genome browser AA seq 87 aa AA seqDB search MWLVSSGPLDDSAAQHDIPPTPQVQKLLSRTGARGHITIGGRLSRDARGFPASSMAKTRA GDWRDAAHVRRWVHSVVAQLEVAGQAG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt gtgtggctcgtcagcagcggccccctggacgattcggccgcgcaacacgacattccgccg acgccccaggtgcagaaactcctgtcccggacaggcgccagggggcacatcaccatcggc ggccgcctgagccgggacgcgaggggtttcccggccagctcgatggccaagaccagggcg ggggactggcgcgatgctgcccacgtacgccgatgggtgcattcggtcgtcgcccagctc gaggtcgccgggcaggccggatag

DBGET integrated database retrieval system