Mycolicibacterium aurum: NCTC10437_03243 Help Entry NCTC10437_03243   CDS       T06794                                  Symbol mbtH_2 Name (GenBank) MbtH like protein   KO K05375   MbtH protein Organism mauu  Mycolicibacterium aurum Pathway mauu00261   Monobactam biosynthesis mauu01100   Metabolic pathways mauu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mauu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NCTC10437_03243 (mbtH_2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mauu01008]     NCTC10437_03243 (mbtH_2) Polyketide biosynthesis proteins [BR:mauu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NCTC10437_03243 (mbtH_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF359 Motif Other DBs NCBI-ProteinID:  VEG55902 UniProt:  A0A448ITX6 LinkDB All DBs Position 1:3433323..3433580 Genome browser AA seq 85 aa AA seqDB search MSSNPFDDENGRFLVLMNGEEQYSLWPTFADVPAGWQTVYGGPDGTDRASALRYVDENWT DMRPRSLRERMEESAAHAADAISRN NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtccagcaatccttttgatgacgagaacggccgcttcctggtgctgatgaacggcgag gagcagtactcgctgtggccgacgttcgccgacgtgccggcagggtggcaaaccgtctac gggggcccggacggcaccgacagggcgagcgcgctgcgctacgtggacgagaactggacc gatatgcgccctcggtcgctgcgagagcggatggaagagtccgcagcccatgccgccgat gcgatttcgcggaattga

DBGET integrated database retrieval system