Labilibaculum antarcticum: ALGA_2643 Help Entry ALGA_2643         CDS       T05376                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mbas  Labilibaculum antarcticum Pathway mbas00020   Citrate cycle (TCA cycle) mbas01100   Metabolic pathways mbas01110   Biosynthesis of secondary metabolites mbas01120   Microbial metabolism in diverse environments mbas01200   Carbon metabolism mbas01210   2-Oxocarboxylic acid metabolism Module mbas_M00009   Citrate cycle (TCA cycle, Krebs cycle) mbas_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:mbas00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ALGA_2643 Enzymes [BR:mbas01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ALGA_2643 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_9 Fer4_6 Fer4_21 Fer4_10 Fer4_15 Fer4_4 Fer4_16 Fer4_22 Fer4_8 Fer4_17 Fer4_13 Fer4_3 ETF_QO Fer4_18 Motif Other DBs NCBI-ProteinID:  BAX80956 UniProt:  A0A1Y1CKN7 LinkDB All DBs Position 3397628..3397855 Genome browser AA seq 75 aa AA seqDB search MAKFKGAIVVDTEKCKGCGICVAACPTGVIDLARDVNGKGYHYAYMANPDACIGCSSCGL VCPDTVITVYRVKAS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcgaaatttaaaggagctattgttgttgataccgaaaaatgcaagggttgtggcata tgtgttgctgcttgtcctacaggggttatcgatctggcaagagacgtaaatggcaaagga tatcattatgcatacatggctaatccagatgcatgtatcggttgttcaagttgcggattg gtttgtcctgataccgtaattactgtttacagggtaaaagcaagctag

DBGET integrated database retrieval system