Melittangium boletus: MEBOL_001873 Help Entry MEBOL_001873      CDS       T05066                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism mbd  Melittangium boletus Pathway mbd00261   Monobactam biosynthesis mbd01100   Metabolic pathways mbd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mbd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MEBOL_001873  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mbd01008]     MEBOL_001873 Polyketide biosynthesis proteins [BR:mbd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MEBOL_001873 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATB28426 UniProt:  A0A250IBT8 LinkDB All DBs Position complement(2271191..2271418) Genome browser AA seq 75 aa AA seqDB search MHPMSDSADTTVYKVVVNHEEQYSIWPADRDNALGWKDAGKQGTKEECLAYIKEVWTDMR PLSLRKKMEEAAKKN NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgcaccccatgagcgatagcgcggacaccaccgtctacaaggtcgtggtcaatcacgag gagcagtactccatctggcccgcggaccgggacaacgccctcggctggaaggacgcgggc aagcagggcacgaaggaggagtgcctcgcgtacatcaaggaggtgtggacggacatgcgc cccttgagccttcgcaagaagatggaagaggcggccaagaagaattag

DBGET integrated database retrieval system