Microbulbifer bruguierae: PVT68_13720 Help Entry PVT68_13720       CDS       T09733                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mbrg  Microbulbifer bruguierae Pathway mbrg00790   Folate biosynthesis mbrg01100   Metabolic pathways mbrg01240   Biosynthesis of cofactors Module mbrg_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mbrg00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     PVT68_13720 (folB) Enzymes [BR:mbrg01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      PVT68_13720 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      PVT68_13720 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      PVT68_13720 (folB) BRITE hierarchy Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  WGL15824 LinkDB All DBs Position 3318142..3318510 Genome browser AA seq 122 aa AA seqDB search MDIVYIRDLKVDTIIGIYDWEREVRQTVSLDIEMAFDIREAARTDNIEHTLNYKAVAKRL IAFIEGAEFLLVETMAEQAAEIVRTEFNVSWLRLRLSKPGAVRGARDVGVIIERGEQRPL EA NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggatattgtttatattcgggatttaaaggtagacaccatcatcggtatctacgattgg gagcgggaggtgcgccagactgtgagcctggatatcgaaatggcgttcgacatccgcgag gccgcgcgcactgacaacatcgagcacactctgaattacaaggcggtggccaagcgactg attgcgtttatcgaaggcgccgaatttctgctggtggaaaccatggccgaacaggcggcg gagattgtgcgcacagagttcaatgtgagctggctgcgcctgcgtttgtccaagcccggc gcggtgcgcggtgcgcgggatgtgggggtcatcattgagcgcggcgaacagcggccgctg gaggcctga

DBGET integrated database retrieval system