Methylocystis bryophila: B1812_21600 Help Entry B1812_21600       CDS       T04837                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mbry  Methylocystis bryophila Pathway mbry00261   Monobactam biosynthesis mbry01100   Metabolic pathways mbry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mbry00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B1812_21600  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mbry01008]     B1812_21600 Polyketide biosynthesis proteins [BR:mbry01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B1812_21600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARN83882 UniProt:  A0A1W6N205 LinkDB All DBs Position p1:complement(34182..34406) Genome browser AA seq 74 aa AA seqDB search MSWEEDETMVYKVVVNHEEQYSIWPDYKEIPDGWRAVGKIGLKPECLSYIKEVWTDMRPL SLRKQMAEAESKIR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtcttgggaagaagacgaaacgatggtctacaaagtcgtcgtgaaccatgaagagcaa tattcgatctggcctgactacaaggagattcccgacggctggcgtgctgttggcaaaatt ggtctcaagcccgaatgcctctcctacatcaaagaagtgtggacggatatgcggccactc agcttgcgcaagcaaatggcggaagcggagtcgaaaattaggtga

DBGET integrated database retrieval system