Methanococcoides burtonii: Mbur_2156 Help Entry Mbur_2156         CDS       T00341                                  Name (GenBank) Pyruvate synthase delta chain   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mbu  Methanococcoides burtonii Pathway mbu00010   Glycolysis / Gluconeogenesis mbu00020   Citrate cycle (TCA cycle) mbu00620   Pyruvate metabolism mbu00640   Propanoate metabolism mbu00650   Butanoate metabolism mbu00680   Methane metabolism mbu00720   Carbon fixation pathways in prokaryotes mbu01100   Metabolic pathways mbu01110   Biosynthesis of secondary metabolites mbu01120   Microbial metabolism in diverse environments mbu01200   Carbon metabolism mbu01210   2-Oxocarboxylic acid metabolism Module mbu_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:mbu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     Mbur_2156    00020 Citrate cycle (TCA cycle)     Mbur_2156    00620 Pyruvate metabolism     Mbur_2156    00640 Propanoate metabolism     Mbur_2156    00650 Butanoate metabolism     Mbur_2156   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     Mbur_2156    00680 Methane metabolism     Mbur_2156   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     Mbur_2156 Enzymes [BR:mbu01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      Mbur_2156 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_17 Fer4_8 Fer4_15 Fer4_3 Fer4_13 Fer4_22 Motif Other DBs NCBI-ProteinID:  ABE53026 UniProt:  Q12U50 LinkDB All DBs Position 2261660..2261920 Genome browser AA seq 86 aa AA seqDB search MTITPGGVCEPGSTLVNKTGGWRTFRPVFDYDKCIKCKLCELLCPDMSVDARDDGFFEFN YDFCKGCGICANECPTDAIEMVLEEK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacaattacaccaggcggcgtttgtgaaccaggatccactcttgtcaacaaaaccggt ggctggagaacattcagaccagttttcgattatgacaaatgcatcaaatgcaaactctgt gagctcctttgtccggacatgtcagtcgatgcaagagatgacggtttctttgagttcaac tacgatttctgcaaaggatgcggtatttgtgcgaacgaatgtccaacggacgctattgag atggttctggaggagaaataa

DBGET integrated database retrieval system