Micromonospora carbonacea: HXZ27_06735 Help Entry HXZ27_06735       CDS       T06722                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mcab  Micromonospora carbonacea Pathway mcab00261   Monobactam biosynthesis mcab01100   Metabolic pathways mcab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mcab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HXZ27_06735  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mcab01008]     HXZ27_06735 Polyketide biosynthesis proteins [BR:mcab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HXZ27_06735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QLD23946 UniProt:  A0A7H8XFY0 LinkDB All DBs Position 1555782..1556012 Genome browser AA seq 76 aa AA seqDB search MNPFDDADGTFLVLVNAESQHSLWPEFAEAPAGWTVAWGPGGRDDALRFVEENWQDMRPK SLALAMDQAENAASHG NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgaatccattcgacgatgcggacggcacgtttctggtgctggtgaacgccgagtcgcag cactcgttgtggccggaattcgccgaggcgccggcgggctggaccgtggcatgggggccg ggcgggcgcgacgacgcgctgcgtttcgtcgaggagaactggcaggacatgcggccgaag agcctcgccctcgccatggaccaggccgagaacgccgcgtcccatgggtga

DBGET integrated database retrieval system