Micromonospora carbonacea: HXZ27_17030 Help Entry HXZ27_17030       CDS       T06722                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mcab  Micromonospora carbonacea Pathway mcab00261   Monobactam biosynthesis mcab01100   Metabolic pathways mcab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mcab00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     HXZ27_17030  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mcab01008]     HXZ27_17030 Polyketide biosynthesis proteins [BR:mcab01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     HXZ27_17030 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QLD25701 UniProt:  A0A1C4VPL7 LinkDB All DBs Position 4196495..4196683 Genome browser AA seq 62 aa AA seqDB search MAETRFLVVRNDEEQYSIWSADRELPAGWHDTGFAGTREECLAHIDTVWTDMRPRSVREA AS NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggccgaaacccgattcctggtcgtgcgcaacgacgaggagcagtactcgatctggtcg gccgaccgggagctccccgcgggctggcacgacaccggcttcgccggcacgcgcgaggag tgcctcgcccacatcgacaccgtctggaccgacatgcgcccccgctccgtacgcgaggca gcatcatga

DBGET integrated database retrieval system