Mycobacterium canettii CIPT 140010059: MCAN_24091 Help Entry MCAN_24091        CDS       T01585                                  Symbol mbtH Name (GenBank) putative conserved protein MBTH   KO K05375   MbtH protein Organism mce  Mycobacterium canettii CIPT 140010059 Pathway mce00261   Monobactam biosynthesis mce01100   Metabolic pathways mce01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mce00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MCAN_24091 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mce01008]     MCAN_24091 (mbtH) Polyketide biosynthesis proteins [BR:mce01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MCAN_24091 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CCC44740 LinkDB All DBs Position complement(2714828..2715043) Genome browser AA seq 71 aa AA seqDB search MSTNPFDDDNGAFFVLVNDEDQHSLWPVFADIPAGWRVVHGEASRAACLDYVEKNWTDLR PKSLRDAMAED NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcaccaatcctttcgatgacgacaacggcgcattcttcgtgctggtcaacgacgaa gaccagcacagcctgtggccggtgttcgccgatatcccggccggctggcgcgtggtgcac ggcgaagccagccgtgccgcctgcctggactacgtggaaaagaactggaccgatctgcgg ccgaagagcctgcgtgacgccatggccgaggactga

DBGET integrated database retrieval system