Mycobacteroides chelonae: BB28_11320 Help Entry BB28_11320        CDS       T04665                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism mche  Mycobacteroides chelonae Pathway mche00261   Monobactam biosynthesis mche01100   Metabolic pathways mche01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mche00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BB28_11320  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mche01008]     BB28_11320 Polyketide biosynthesis proteins [BR:mche01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BB28_11320 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANA98266 LinkDB All DBs Position 2250960..2251175 Genome browser AA seq 71 aa AA seqDB search MSTNPFDNESGVFYVLVNDEEQHSLWPTAIEVPAQWRVAFGEASRADCVEYIEAHWTDMR PKSLRDAMAGS NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagtaccaacccatttgataacgagagcggcgtcttttacgtactggtcaacgacgag gagcagcacagtctgtggccgacggccattgaggtgccagcgcagtggcgcgtggccttt ggcgaggcctcgcgtgccgattgcgtcgagtacatcgaggcccactggaccgacatgcgg cccaagagcctccgcgacgcgatggcgggcagctag

DBGET integrated database retrieval system