Methanoculleus chikugoensis: MchiMG62_09760 Help Entry MchiMG62_09760    CDS       T07488                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mchk  Methanoculleus chikugoensis Pathway mchk00020   Citrate cycle (TCA cycle) mchk00720   Carbon fixation pathways in prokaryotes mchk01100   Metabolic pathways mchk01110   Biosynthesis of secondary metabolites mchk01120   Microbial metabolism in diverse environments mchk01200   Carbon metabolism mchk01210   2-Oxocarboxylic acid metabolism Module mchk_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mchk00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MchiMG62_09760   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MchiMG62_09760 Enzymes [BR:mchk01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MchiMG62_09760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_16 Fer4_4 Fer4_9 Fer4_15 Fer4_3 Fer4_18 Fer4_13 Fer4_8 Motif Other DBs NCBI-ProteinID:  BBL67795 LinkDB All DBs Position complement(968781..969053) Genome browser AA seq 90 aa AA seqDB search MKLVIDESRCKGCNLCVLVCPYGIFREGTELNSRGIVAPVLDRPERCANCRLQALYGRML CGVCHMICPDQAISWVEEKPFEPHKVEVEF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaactcgtcatcgatgaaagccgctgcaaaggatgcaatctctgcgtgctggtctgc ccctacggtatatttcgggagggaacggaactcaacagccggggaatcgtggccccggtc ctcgaccgccccgaacggtgtgcgaactgcaggctgcaggccctctacggcaggatgctc tgcggggtctgccacatgatctgccccgaccaggccatctcctgggtcgaagagaagccg ttcgaaccgcacaaagtggaggtggagttttga

DBGET integrated database retrieval system