Micromonospora craniellae: ID554_06695 Help Entry ID554_06695       CDS       T06957                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mcra  Micromonospora craniellae Pathway mcra00261   Monobactam biosynthesis mcra01100   Metabolic pathways mcra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mcra00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ID554_06695  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mcra01008]     ID554_06695 Polyketide biosynthesis proteins [BR:mcra01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ID554_06695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QOC93356 LinkDB All DBs Position complement(1469326..1469544) Genome browser AA seq 72 aa AA seqDB search MKQPDDVRFKVVVNHEEQYSVWWSDRSNPPGWQDEGTDGTRQECLDHIDRVWKDMRPRSV RTVREAIQGVQA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaagcagccggatgacgtccgtttcaaggtcgtggtcaaccacgaggagcagtactcg gtgtggtggtcggaccggtccaacccgccgggctggcaggacgagggcaccgacggcacc cgtcaggagtgcctcgaccacatcgaccgggtgtggaaggacatgcggccgcgcagcgtg cggaccgttcgggaagcgatccagggagtgcaggcatga

DBGET integrated database retrieval system