Methanobacterium congolense: MCBB_0233 Help Entry MCBB_0233         CDS       T04503                                  Name (GenBank) putative ferredoxin MJ0146   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mcub  Methanobacterium congolense Pathway mcub00020   Citrate cycle (TCA cycle) mcub00720   Carbon fixation pathways in prokaryotes mcub01100   Metabolic pathways mcub01110   Biosynthesis of secondary metabolites mcub01120   Microbial metabolism in diverse environments mcub01200   Carbon metabolism mcub01210   2-Oxocarboxylic acid metabolism Module mcub_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mcub00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MCBB_0233   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MCBB_0233 Enzymes [BR:mcub01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MCBB_0233 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_9 Fer4_10 Fer4_6 Fer4_2 Fer4_21 Fer4_16 ETF_QO Fer4_4 Fer4_8 Fer4_13 Fer4_3 Fer4_22 Fer4_17 Fer4_15 Motif Other DBs NCBI-ProteinID:  SCG84821 UniProt:  A0A1D3KZJ4 LinkDB All DBs Position I:251020..251229 Genome browser AA seq 69 aa AA seqDB search MITVNENLCKGCNICTEFCPKKVYEQSKTPNKKGVRLPIPAHGERCTRCGTCTLMCPDQA IRVGEKDED NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgataaccgttaatgagaatttatgtaaaggatgcaatatctgcactgagttctgtccc aaaaaggtttacgaacagtcaaaaacacccaataaaaagggtgtgcgtctgccaatacct gcacatggggaaagatgcaccagatgcggtacttgcactttaatgtgtccagatcaagca ataagggtgggtgaaaaggatgaagactga

DBGET integrated database retrieval system