Methylomonas sp. DH-1: AYM39_11720 Help Entry AYM39_11720       CDS       T04396                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism mdh  Methylomonas sp. DH-1 Pathway mdh00261   Monobactam biosynthesis mdh01100   Metabolic pathways mdh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mdh00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AYM39_11720  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mdh01008]     AYM39_11720 Polyketide biosynthesis proteins [BR:mdh01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AYM39_11720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  ANE55782 UniProt:  A0A172U995 LinkDB All DBs Position complement(2636637..2636837) Genome browser AA seq 66 aa AA seqDB search MVVMAEELETRFVVVCNHEQQHALWPAFKPVPAGWQQVKSADSRENCLDYVNRSWTDIRP LSLQAL NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atggtcgttatggctgaagaattggaaacgcgtttcgtcgtggtctgcaaccacgaacag caacacgccttatggccggctttcaagccggtacccgccggttggcaacaggtcaagtct gccgacagccgggaaaactgtctggattacgtcaaccggagctggaccgacatccggccg ctgagcttgcaagccttatga

DBGET integrated database retrieval system