Mycolicibacterium duvalii: MDUV_07180 Help Entry MDUV_07180        CDS       T06492                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism mdu  Mycolicibacterium duvalii Pathway mdu00261   Monobactam biosynthesis mdu01100   Metabolic pathways mdu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mdu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MDUV_07180  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mdu01008]     MDUV_07180 Polyketide biosynthesis proteins [BR:mdu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MDUV_07180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBX15858 UniProt:  A0A7I7JWU0 LinkDB All DBs Position 792707..792922 Genome browser AA seq 71 aa AA seqDB search MSANPFDDDDASFYVLINDEEQYSLWPVFADVPAGWQVVFGESSRADCLAYVEQNWTDLR PRSLREAMAAD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcgccaacccattcgatgacgacgacgcgagcttctacgtgctgatcaacgacgag gaacagtacagtctgtggccggtcttcgccgacgtgccggccgggtggcaggtggtgttc ggggagagctcccgtgcggactgcctggcctacgtcgaacagaactggaccgatctgcgg ccgcgcagtctgcgcgaggcgatggccgcggactga

DBGET integrated database retrieval system