Mycobacterium dioxanotrophicus: BTO20_12375 Help Entry BTO20_12375       CDS       T05102                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mdx  Mycobacterium dioxanotrophicus Pathway mdx00261   Monobactam biosynthesis mdx01100   Metabolic pathways mdx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mdx00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BTO20_12375  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mdx01008]     BTO20_12375 Polyketide biosynthesis proteins [BR:mdx01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BTO20_12375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ART69273 UniProt:  A0A1Y0C265 LinkDB All DBs Position 2581382..2581594 Genome browser AA seq 70 aa AA seqDB search MSTNPFDDERGTFVVLVNDEDQFSLWPAFADVPVGWRAVFGAGSRSDCLGYVEETWTDLR PRSLREATAR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccgttcgatgacgagcgcggcaccttcgtcgttctggtgaacgacgag gaccaattcagcctgtggccggcgttcgccgacgtgcccgtgggatggcgggcggtcttc ggtgcgggcagccggtcggactgcctgggctatgtcgaggagacctggaccgatttgcgg ccgcgaagcctgcgtgaggccacggcccggtag

DBGET integrated database retrieval system