Methylosinus sp. C49: MSC49_21160 Help Entry MSC49_21160       CDS       T09855                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mecq  Methylosinus sp. C49 Pathway mecq00261   Monobactam biosynthesis mecq01100   Metabolic pathways mecq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mecq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MSC49_21160  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mecq01008]     MSC49_21160 Polyketide biosynthesis proteins [BR:mecq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MSC49_21160 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBU62181 LinkDB All DBs Position complement(2253730..2253954) Genome browser AA seq 74 aa AA seqDB search MAWDEEDNATYAVVVNEEEQYSIWPEHKPIPGGWRSVGRTGSKTDCLDFIREVWTDMRPL SLRHRMQEASPPRS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcgtgggacgaagaagacaacgcgacctatgcggtcgtcgtcaatgaagaggaacaa tattcgatctggccggaacacaaaccgattccgggcgggtggcgttcggtggggagaacc ggctcgaagacggattgtctcgacttcattcgagaggtctggacagacatgcgcccgctc agcttgcgtcaccgaatgcaggaggcgtctcctccgcgaagctag

DBGET integrated database retrieval system