Methylosinus sp. C49: MSC49_37350 Help Entry MSC49_37350       CDS       T09855                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism mecq  Methylosinus sp. C49 Pathway mecq00261   Monobactam biosynthesis mecq01100   Metabolic pathways mecq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mecq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MSC49_37350  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mecq01008]     MSC49_37350 Polyketide biosynthesis proteins [BR:mecq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MSC49_37350 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBU63800 LinkDB All DBs Position pMSC49a:complement(90513..90722) Genome browser AA seq 69 aa AA seqDB search MDDAQINPFDDERLSFVVLVNSRAQYSLWPDFSADPKGWRRVFGPGTRLQCMQYVDDHWI DMRPCAEAG NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggatgacgcgcagatcaatcccttcgacgacgagcgtctgagcttcgtcgttctcgtc aactcccgggcgcaatacagcctgtggcccgatttctccgccgatccgaaaggatggcgc cgtgtcttcggtccggggacgcgcctgcaatgcatgcaatatgtcgacgatcattggatc gacatgcgcccatgcgcagaggccggctga

DBGET integrated database retrieval system