Methanoplanus sp. FWC-SCC4: F1737_01575 Help Entry F1737_01575       CDS       T09667                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mefw  Methanoplanus sp. FWC-SCC4 Pathway mefw00020   Citrate cycle (TCA cycle) mefw00720   Carbon fixation pathways in prokaryotes mefw01100   Metabolic pathways mefw01110   Biosynthesis of secondary metabolites mefw01120   Microbial metabolism in diverse environments mefw01200   Carbon metabolism mefw01210   2-Oxocarboxylic acid metabolism Module mefw_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mefw00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     F1737_01575   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     F1737_01575 Enzymes [BR:mefw01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      F1737_01575 BRITE hierarchy Motif Pfam:  Fer4_7 Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_21 Fer4_16 Fer4_9 Fer4_4 Fer4_3 Fer4_8 Motif Other DBs NCBI-ProteinID:  WOF15460 UniProt:  A0AA97F9U9 LinkDB All DBs Position 334830..335102 Genome browser AA seq 90 aa AA seqDB search MKLVIEEKLCKGCNLCTMVCPYNIFQEGTKLNEKGIVVPVLDRPERCTNCRLQKLYQRRL CGVCQLICPDQAIKWVEEGPYEPHKVVIEF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaacttgttatagaagagaaactctgcaaaggatgcaatctttgtacaatggtctgt ccctacaatatttttcaggaaggaacgaaactcaatgaaaagggtatagtagttcctgtt cttgacagacccgaaagatgcacaaattgcagacttcaaaaactgtaccaaaggcgtttg tgtggggtatgtcagcttatatgccctgatcaggcaataaaatgggttgaggaaggtcca tatgaacctcataaagtggtgatagagttttga

DBGET integrated database retrieval system