Candidatus Methanoliparum sp. LAM-1: MTLP_04540 Help Entry MTLP_04540        CDS       T07692                                  Symbol porC_1 Name (GenBank) Pyruvate synthase subunit D   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism melu  Candidatus Methanoliparum sp. LAM-1 Pathway melu00010   Glycolysis / Gluconeogenesis melu00020   Citrate cycle (TCA cycle) melu00620   Pyruvate metabolism melu00640   Propanoate metabolism melu00650   Butanoate metabolism melu00680   Methane metabolism melu00720   Carbon fixation pathways in prokaryotes melu01100   Metabolic pathways melu01110   Biosynthesis of secondary metabolites melu01120   Microbial metabolism in diverse environments melu01200   Carbon metabolism melu01210   2-Oxocarboxylic acid metabolism Module melu_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:melu00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MTLP_04540 (porC_1)    00020 Citrate cycle (TCA cycle)     MTLP_04540 (porC_1)    00620 Pyruvate metabolism     MTLP_04540 (porC_1)    00640 Propanoate metabolism     MTLP_04540 (porC_1)    00650 Butanoate metabolism     MTLP_04540 (porC_1)   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MTLP_04540 (porC_1)    00680 Methane metabolism     MTLP_04540 (porC_1)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     MTLP_04540 (porC_1) Enzymes [BR:melu01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      MTLP_04540 (porC_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_7 Fer4_10 Fer4_6 Fer4_9 Fer4_16 Fer4_17 Fer4_4 Fer4_3 Mcp40H-20_sensor Fer4_8 Fer4_22 Motif Other DBs NCBI-ProteinID:  BDC35772 LinkDB All DBs Position complement(419701..419991) Genome browser AA seq 96 aa AA seqDB search MNKAKRNDIRLIPGGITRPKTTITNKTGFWRTFIPIFNEERCNKCGICDIFCPENCIIIN EEGYRHPNYDFCKGCGICAEECPKDAIKMILESKEG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaaggcaaagagaaatgatataagattgattccaggaggaataacaagaccaaaa acgaccattacaaacaagaccggtttctggagaacttttattccaatctttaacgaagaa agatgtaacaaatgtggaatatgcgatatattctgtccagaaaactgtattatcataaat gaagaaggatataggcatccaaactacgatttctgcaaaggatgcggaatctgcgcagaa gaatgtccaaaagatgctataaaaatgatacttgaatcaaaggagggataa

DBGET integrated database retrieval system