Methanobacterium alkalithermotolerans: HYG87_04345 Help Entry HYG87_04345       CDS       T07794                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism meme  Methanobacterium alkalithermotolerans Pathway meme00020   Citrate cycle (TCA cycle) meme00720   Carbon fixation pathways in prokaryotes meme01100   Metabolic pathways meme01110   Biosynthesis of secondary metabolites meme01120   Microbial metabolism in diverse environments meme01200   Carbon metabolism meme01210   2-Oxocarboxylic acid metabolism Module meme_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:meme00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     HYG87_04345   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     HYG87_04345 Enzymes [BR:meme01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      HYG87_04345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_21 Fer4_16 Fer4_9 Fer4_6 Fer4_2 Fer4_8 Fer4_15 Fer4_4 ETF_QO Fer4_3 Fer4_22 Fer4_17 Fer4_13 Fer4_18 Motif Other DBs NCBI-ProteinID:  QUH23052 UniProt:  A0A8T8K5C9 LinkDB All DBs Position complement(905462..905668) Genome browser AA seq 68 aa AA seqDB search MIKLDPNLCKGCNICMEFCPKKVYEQSKTLDKKGVHIPIPKNQDECSKCNLCALMCPDQA IKVEEDDE NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgataaaactagaccctaatctatgtaagggatgcaatatttgcatggaattctgtcct aaaaaggtatatgagcaatctaaaactttggataagaagggagtgcacatccccatacca aaaaatcaggatgaatgttctaaatgtaatttatgtgctttgatgtgtcctgatcaagct ataaaggtggaggaagacgatgaataa

DBGET integrated database retrieval system