Methanoplanus endosymbiosus: L6E24_10435 Help Entry L6E24_10435       CDS       T08358                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mend  Methanoplanus endosymbiosus Pathway mend00020   Citrate cycle (TCA cycle) mend00720   Carbon fixation pathways in prokaryotes mend01100   Metabolic pathways mend01110   Biosynthesis of secondary metabolites mend01120   Microbial metabolism in diverse environments mend01200   Carbon metabolism mend01210   2-Oxocarboxylic acid metabolism Module mend_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mend00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L6E24_10435   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     L6E24_10435 Enzymes [BR:mend01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L6E24_10435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_21 Fer4_9 Fer4_16 Fer4_4 Fer4_15 Fer4_8 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  UUX91776 UniProt:  A0A9E7PN64 LinkDB All DBs Position complement(2334017..2334289) Genome browser AA seq 90 aa AA seqDB search MKLIIDETRCKGCNLCTTVCPYSIFTEGKKLNERGIVVPVLDRPQRCTNCRLRNLYNRQL CGVCQLICPDQAISWVEETEGLTEKVVIEY NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaacttataattgatgaaacccgctgcaagggatgcaacctctgcacgacagtatgc ccctacagcatatttacggaaggtaaaaaactaaacgagaggggaatagttgtacctgtc cttgacaggccgcagaggtgcacaaactgcaggctgaggaatttatataacaggcagctc tgcggagtatgccagctcatatgtccggatcaggcgatatcatgggttgaagagacagaa ggccttacagagaaggtggtgattgaatattga

DBGET integrated database retrieval system