Methanogenium sp. S4BF: L1S32_00380 Help Entry L1S32_00380       CDS       T09590                                  Name (GenBank) 4Fe-4S binding protein   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mesb  Methanogenium sp. S4BF Pathway mesb00010   Glycolysis / Gluconeogenesis mesb00020   Citrate cycle (TCA cycle) mesb00620   Pyruvate metabolism mesb00633   Nitrotoluene degradation mesb00640   Propanoate metabolism mesb00650   Butanoate metabolism mesb00680   Methane metabolism mesb00720   Carbon fixation pathways in prokaryotes mesb01100   Metabolic pathways mesb01110   Biosynthesis of secondary metabolites mesb01120   Microbial metabolism in diverse environments mesb01200   Carbon metabolism mesb01210   2-Oxocarboxylic acid metabolism Module mesb_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA mesb_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mesb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     L1S32_00380    00020 Citrate cycle (TCA cycle)     L1S32_00380    00620 Pyruvate metabolism     L1S32_00380    00640 Propanoate metabolism     L1S32_00380    00650 Butanoate metabolism     L1S32_00380   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     L1S32_00380    00680 Methane metabolism     L1S32_00380   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     L1S32_00380 Enzymes [BR:mesb01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      L1S32_00380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_10 Fer4_9 Fer4_21 Fer4_7 Fer4_16 Fer4_8 Fer4_15 Fer4_4 Fer4_13 Fer4_17 Fer4_3 Fer4_22 Motif Other DBs NCBI-ProteinID:  WFN34613 LinkDB All DBs Position complement(69913..70170) Genome browser AA seq 85 aa AA seqDB search MALRIGCAAAPGRAQDNKTGSWRVYMPVVDMEKCILCGTCILLCPETAVSDNDGQILFDL DFCKGCGVCAKECPADAISMIQEEK NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggcacttcgtatcggatgcgctgctgcacccggcagggcacaggataacaaaaccgga tcatggcgggtttacatgccggtcgtggatatggagaaatgcatcctctgcggcacctgc atactgctctgcccggaaacggcagtcagtgataatgatggccagatcctctttgacctt gacttctgcaagggctgcggcgtatgcgccaaggaatgccctgcagatgcgattagcatg attcaggaggaaaaataa

DBGET integrated database retrieval system