Methanogenium sp. S4BF: L1S32_06480 Help Entry L1S32_06480       CDS       T09590                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mesb  Methanogenium sp. S4BF Pathway mesb00020   Citrate cycle (TCA cycle) mesb00720   Carbon fixation pathways in prokaryotes mesb01100   Metabolic pathways mesb01110   Biosynthesis of secondary metabolites mesb01120   Microbial metabolism in diverse environments mesb01200   Carbon metabolism mesb01210   2-Oxocarboxylic acid metabolism Module mesb_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mesb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L1S32_06480   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     L1S32_06480 Enzymes [BR:mesb01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L1S32_06480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_2 Fer4 Fer4_6 Fer4_10 Fer4_21 Fer4_9 Fer4_4 Fer4_16 Fer4_15 Fer4_3 Fer4_13 Fer4_8 Fer4_22 Motif Other DBs NCBI-ProteinID:  WFN33503 LinkDB All DBs Position 1355508..1355780 Genome browser AA seq 90 aa AA seqDB search MKLIIDERRCKGCNLCTTVCPYTIFQEGRKLNERGIIVPILDRPERCTNCRLRHLYGRQL CGACQMICPDQAICWKEEEPYSENNVVIEF NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaaactaataatcgatgaacggcgatgcaagggatgcaacctctgcaccaccgtctgc ccatataccatatttcaggaaggcagaaaactcaatgagcggggcattatcgtccccatc cttgaccggccggaacggtgcaccaactgccgcctgcgccacctctacggcagacagctc tgcggcgcatgccagatgatctgccccgaccaggccatctgctggaaagaagaagaacct tattccgagaataacgtggtgatcgagttttga

DBGET integrated database retrieval system