Methanocaldococcus lauensis SG7: MLAUSG7_1629 Help Entry MLAUSG7_1629      CDS       T07631                                  Symbol porD Name (GenBank) Pyruvate synthase subunit PorD   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mesg  Methanocaldococcus lauensis SG7 Pathway mesg00010   Glycolysis / Gluconeogenesis mesg00020   Citrate cycle (TCA cycle) mesg00620   Pyruvate metabolism mesg00633   Nitrotoluene degradation mesg00640   Propanoate metabolism mesg00650   Butanoate metabolism mesg00680   Methane metabolism mesg00720   Carbon fixation pathways in prokaryotes mesg01100   Metabolic pathways mesg01110   Biosynthesis of secondary metabolites mesg01120   Microbial metabolism in diverse environments mesg01200   Carbon metabolism mesg01210   2-Oxocarboxylic acid metabolism Module mesg_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA mesg_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mesg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MLAUSG7_1629 (porD)    00020 Citrate cycle (TCA cycle)     MLAUSG7_1629 (porD)    00620 Pyruvate metabolism     MLAUSG7_1629 (porD)    00640 Propanoate metabolism     MLAUSG7_1629 (porD)    00650 Butanoate metabolism     MLAUSG7_1629 (porD)   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MLAUSG7_1629 (porD)    00680 Methane metabolism     MLAUSG7_1629 (porD)   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     MLAUSG7_1629 (porD) Enzymes [BR:mesg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      MLAUSG7_1629 (porD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_6 Fer4_9 Fer4_10 Fer4_7 Fer4_16 Fer4_2 Fer4_17 Fer4_4 Fer4_3 Fer4_8 Fer4_13 IceA2 CH_2 Motif Other DBs NCBI-ProteinID:  CAB3290202 UniProt:  A0A8D6PX44 LinkDB All DBs Position I:1526856..1527140 Genome browser AA seq 94 aa AA seqDB search MGKWGVIVMVTIAAIIYEPGNSIRNKTGSWRTFRPILDNNKCVKCENCYIFCPEGAIQED ENGNFKIDYDYCKGCLICMNECPVNAITKVREEK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgggtaaatggggtgttatagttatggtaacaattgccgcaattatttatgaaccagga aattcaattagaaataaaacaggtagttggagaacatttagacctattttagataataat aaatgtgtaaagtgtgaaaattgctatatcttctgtccagagggggctattcaagaggat gaaaatgggaattttaaaatagattacgattactgtaaaggatgtttaatctgtatgaac gaatgccctgtaaatgcaataactaaggttagagaagagaaataa

DBGET integrated database retrieval system