Mesorhizobium sp. Pch-S: C1M53_28395 Help Entry C1M53_28395       CDS       T05918                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mesp  Mesorhizobium sp. Pch-S Pathway mesp00790   Folate biosynthesis mesp01100   Metabolic pathways mesp01240   Biosynthesis of cofactors Module mesp_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mesp00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     C1M53_28395 (folB) Enzymes [BR:mesp01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      C1M53_28395 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      C1M53_28395 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      C1M53_28395 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB AF2331-like Motif Other DBs NCBI-ProteinID:  QAZ46263 UniProt:  A0A4P6HBD8 LinkDB All DBs Position complement(6000027..6000386) Genome browser AA seq 119 aa AA seqDB search MYVIRMKNCAFFARHGVHDEEERLGQRFYVDAVLTVDPAKELDEDAIDSTVDYGVAFTVI EKIITGERRFLIEALALDVAKALTRRFPQIKTAEITVRKPNAPVPGVLDHVEVTVVWPQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtacgtcatccggatgaagaactgcgccttctttgccaggcacggcgtgcatgacgag gaagagcggcttggccagcgcttctatgtcgatgcggtgctgaccgtcgatccggccaag gaactggacgaggatgccatcgacagcactgtcgactatggcgttgcgttcaccgttatc gagaagatcatcaccggcgagcggcgttttctcatcgaggccctggcacttgatgtcgcc aaggcgctgacccggcgtttcccgcagatcaagacggccgaaatcaccgtccgcaagccc aatgcgccggtgcccggcgtgctcgatcacgtcgaggtcaccgttgtctggccgcaataa

DBGET integrated database retrieval system