Methanosphaera sp. BMS: AW729_08555 Help Entry AW729_08555       CDS       T05504                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism metb  Methanosphaera sp. BMS Pathway metb00020   Citrate cycle (TCA cycle) metb00720   Carbon fixation pathways in prokaryotes metb01100   Metabolic pathways metb01110   Biosynthesis of secondary metabolites metb01120   Microbial metabolism in diverse environments metb01200   Carbon metabolism metb01210   2-Oxocarboxylic acid metabolism Module metb_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:metb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     AW729_08555   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     AW729_08555 Enzymes [BR:metb01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      AW729_08555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_8 Fer4_3 Fer4_13 Fer4_15 Fer4_17 ETF_QO Motif Other DBs NCBI-ProteinID:  AWX33142 UniProt:  A0A2Z4LAA7 LinkDB All DBs Position 2328074..2328274 Genome browser AA seq 66 aa AA seqDB search MIYLNEDLCKGCYLCMEVCPRKVYTPSENLNHKGIRVPVFDLEKCVKCQLCTLMCPDQAI LIEDDD NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgatatacttaaacgaagacttgtgtaaaggatgctatttatgtatggaagtatgtcca cgtaaagtatacacaccttctgaaaatttaaatcataaaggaatacgtgtacctgtattt gacctggaaaaatgtgttaaatgccagttatgtacattaatgtgtcctgatcaagcaatt ttaatagaggatgatgattaa

DBGET integrated database retrieval system