Methanothermobacter sp. EMTCatA1: tca_00993 Help Entry tca_00993         CDS       T05328                                  Name (GenBank) Ferredoxin-2   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mete  Methanothermobacter sp. EMTCatA1 Pathway mete00020   Citrate cycle (TCA cycle) mete00720   Carbon fixation pathways in prokaryotes mete01100   Metabolic pathways mete01110   Biosynthesis of secondary metabolites mete01120   Microbial metabolism in diverse environments mete01200   Carbon metabolism mete01210   2-Oxocarboxylic acid metabolism Module mete_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mete00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     tca_00993   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     tca_00993 Enzymes [BR:mete01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      tca_00993 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_6 Fer4_2 Fer4_7 Fer4_21 Fer4_9 Fer4_4 Fer4_13 Fer4_16 Fer4_8 Fer4_3 Fer4_17 Fer4_15 ETF_QO Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  BAZ99059 UniProt:  A0A223ZFY8 LinkDB All DBs Position 923504..923707 Genome browser AA seq 67 aa AA seqDB search MIKIDSDLCKGCDICREFCPEGVYVRSEELNRKGVHEPVPKNLEKCTGCKLCMLLCPDQA IVVYEDD NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgataaagatagattcagatctctgtaagggatgtgacatatgcagagagttctgcccc gaaggggtctatgttagatcagaggaactcaacaggaagggtgtgcatgagccagtcccg aaaaatctggaaaaatgcacgggatgcaagctctgcatgctcctgtgtccagatcaggcg atagtggtgtatgaagatgactga

DBGET integrated database retrieval system