Methanofervidicoccus sp. A16: CFE53_05040 Help Entry CFE53_05040       CDS       T06169                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism metf  Methanofervidicoccus sp. A16 Pathway metf00020   Citrate cycle (TCA cycle) metf00720   Carbon fixation pathways in prokaryotes metf01100   Metabolic pathways metf01110   Biosynthesis of secondary metabolites metf01120   Microbial metabolism in diverse environments metf01200   Carbon metabolism metf01210   2-Oxocarboxylic acid metabolism Module metf_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:metf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CFE53_05040   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     CFE53_05040 Enzymes [BR:metf01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CFE53_05040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_21 Fer4_9 Fer4_7 Fer4_16 Fer4_2 Fer4_4 Fer4_10 Fer4_3 Fer4_8 Motif Other DBs NCBI-ProteinID:  AXI25529 UniProt:  A0A510BCS3 LinkDB All DBs Position 1091035..1091235 Genome browser AA seq 66 aa AA seqDB search MKIEINENYCKGCDICIFICPRDVFVKSEKLNKKGIYPPIPKYPENCTKCQLCVLQCPDQ AISLLD NT seq 201 nt NT seq  +upstreamnt  +downstreamnt gtgaaaattgaaataaatgagaactactgtaaaggatgcgatatttgtatattcatatgt ccaagagatgtgtttgtaaaatctgaaaaattaaataaaaaaggtatttatccacctata cctaaatatcctgagaattgtaccaagtgccagctttgtgtattacagtgtccagatcag gctatttctctcttggattaa

DBGET integrated database retrieval system