Methanobacterium sp. MB1: MBMB1_0214 Help Entry MBMB1_0214        CDS       T02957                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism meth  Methanobacterium sp. MB1 Pathway meth00020   Citrate cycle (TCA cycle) meth00720   Carbon fixation pathways in prokaryotes meth01100   Metabolic pathways meth01110   Biosynthesis of secondary metabolites meth01120   Microbial metabolism in diverse environments meth01200   Carbon metabolism meth01210   2-Oxocarboxylic acid metabolism Module meth_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:meth00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MBMB1_0214   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MBMB1_0214 Enzymes [BR:meth01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MBMB1_0214 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_21 Fer4_7 Fer4_6 Fer4_10 Fer4_2 Fer4_9 Fer4_16 Fer4_4 Fer4_8 Fer4_13 ETF_QO Fer4_15 Fer4_22 Fer4_3 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  CDG64332 UniProt:  U6EAX5 LinkDB All DBs Position 212309..212527 Genome browser AA seq 72 aa AA seqDB search MVDFMITVNENLCKGCNICTEFCPRKVYEKSGKLNKKGVHVPAPENEDKCTQCQLCVLMC PDQAIKVDEKSG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggtagatttcatgataaccgttaatgagaatctttgcaaaggctgtaacatctgcacc gagttttgcccacgtaaagtttatgagaaatcaggcaagctcaataagaagggtgtgcat gttccagcacctgaaaatgaggacaaatgcactcagtgtcaactgtgtgtcctgatgtgt cctgatcaggcaatcaaggtagatgaaaaaagtggatga

DBGET integrated database retrieval system