Methanobacterium sp. MB1: MBMB1_1539 Help Entry MBMB1_1539        CDS       T02957                                  Name (GenBank) hypothetical protein   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism meth  Methanobacterium sp. MB1 Pathway meth00010   Glycolysis / Gluconeogenesis meth00020   Citrate cycle (TCA cycle) meth00620   Pyruvate metabolism meth00633   Nitrotoluene degradation meth00640   Propanoate metabolism meth00650   Butanoate metabolism meth00680   Methane metabolism meth00720   Carbon fixation pathways in prokaryotes meth01100   Metabolic pathways meth01110   Biosynthesis of secondary metabolites meth01120   Microbial metabolism in diverse environments meth01200   Carbon metabolism meth01210   2-Oxocarboxylic acid metabolism Module meth_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA meth_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:meth00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     MBMB1_1539    00020 Citrate cycle (TCA cycle)     MBMB1_1539    00620 Pyruvate metabolism     MBMB1_1539    00640 Propanoate metabolism     MBMB1_1539    00650 Butanoate metabolism     MBMB1_1539   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     MBMB1_1539    00680 Methane metabolism     MBMB1_1539   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     MBMB1_1539 Enzymes [BR:meth01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      MBMB1_1539 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_6 Fer4_21 Fer4_9 Fer4_7 Fer4_10 Fer4_16 Fer4_4 Fer4_15 Fer4_3 Fer4_8 Fer4_13 Fer4_17 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  CDG65633 UniProt:  U6EEH0 LinkDB All DBs Position 1526079..1526321 Genome browser AA seq 80 aa AA seqDB search MVSTGACVKEPGSTRNNKTGSWRTFKPILDKEKCIQCGNCVLFCPEGCINQDYDIDYDYC KGCGICAEECPVKAINMERG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtatctactggagcatgtgttaaagaacctggaagcacccgaaacaacaaaaccgga agttggagaaccttcaagcccattctggataaagaaaaatgtatacaatgcggtaactgt gttcttttctgtccggaaggatgtataaaccaagattatgatatagattacgattactgt aaaggctgtggtatctgcgctgaagaatgcccagttaaagcaataaacatggagagagga taa

DBGET integrated database retrieval system