Methanothermobacter sp. THM-2: FZP68_03880 Help Entry FZP68_03880       CDS       T07724                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism metj  Methanothermobacter sp. THM-2 Pathway metj00020   Citrate cycle (TCA cycle) metj00720   Carbon fixation pathways in prokaryotes metj01100   Metabolic pathways metj01110   Biosynthesis of secondary metabolites metj01120   Microbial metabolism in diverse environments metj01200   Carbon metabolism metj01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:metj00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     FZP68_03880   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     FZP68_03880 Enzymes [BR:metj01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      FZP68_03880 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_7 Fer4_2 Fer4_21 Fer4_6 Fer4_9 Fer4_4 Fer4_8 Fer4_16 Fer4_13 Fer4_3 Fer4_17 ETF_QO Fer4_22 Fer4_15 Motif Other DBs NCBI-ProteinID:  QHN07952 UniProt:  A0A6B9TJ10 LinkDB All DBs Position complement(732702..732911) Genome browser AA seq 69 aa AA seqDB search MTMIKIDSDLCKGCDICREFCPEGVYVRSEELNRKGVHEPIPKNLDKCTGCKICMLMCPD QAIVVYDDD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt attaccatgataaagatagattcagatctctgtaagggatgtgacatatgcagggagttc tgccctgaaggtgtctatgtcaggtcagaggaactcaacaggaagggagtgcatgaaccc atccctaaaaatctggataaatgtacgggatgcaagatatgcatgctgatgtgtcctgat caggcgatagtggtgtatgacgatgactga

DBGET integrated database retrieval system