Methanothermobacter sp. KEPCO-1: FVF72_06450 Help Entry FVF72_06450       CDS       T06317                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism metk  Methanothermobacter sp. KEPCO-1 Pathway metk00020   Citrate cycle (TCA cycle) metk00720   Carbon fixation pathways in prokaryotes metk01100   Metabolic pathways metk01110   Biosynthesis of secondary metabolites metk01120   Microbial metabolism in diverse environments metk01200   Carbon metabolism metk01210   2-Oxocarboxylic acid metabolism Module metk_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:metk00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     FVF72_06450   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     FVF72_06450 Enzymes [BR:metk01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      FVF72_06450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_10 Fer4_2 Fer4_6 Fer4_9 Fer4_7 Fer4_21 Fer4_4 Fer4_16 Fer4_8 Fer4_13 Fer4_3 Fer4_17 ETF_QO Fer4_15 Fer4_22 Fer4_18 Motif Other DBs NCBI-ProteinID:  QEF94818 UniProt:  A0A5B9M316 LinkDB All DBs Position complement(1208745..1208948) Genome browser AA seq 67 aa AA seqDB search MIKIDSDLCKGCDICREFCPEGVYVRSEELNRKGVHEPIPKNLDKCTGCKLCMLMCPDQA IVVYDDD NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgataaagatagattcagatctctgtaagggatgtgacatatgcagggagttctgccct gaaggtgtctatgtcaggtcagaggaactcaacaggaagggagtgcatgaacccatccct aaaaatctggataaatgtacgggatgcaagctatgcatgctaatgtgtcctgatcaggcg atagtggtgtatgacgatgactga

DBGET integrated database retrieval system