Methanobacterium sp. BAmetb5: CIT02_05945 Help Entry CIT02_05945       CDS       T05745                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism meto  Methanobacterium sp. BAmetb5 Pathway meto00020   Citrate cycle (TCA cycle) meto00720   Carbon fixation pathways in prokaryotes meto01100   Metabolic pathways meto01110   Biosynthesis of secondary metabolites meto01120   Microbial metabolism in diverse environments meto01200   Carbon metabolism meto01210   2-Oxocarboxylic acid metabolism Module meto_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:meto00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CIT02_05945   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     CIT02_05945 Enzymes [BR:meto01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CIT02_05945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_6 Fer4_10 Fer4_16 Fer4_2 Fer4_9 Fer4_4 Fer4_8 Fer4_13 Fer4_22 ETF_QO Fer4_3 Fer4_15 Fer4_18 Motif Other DBs NCBI-ProteinID:  AXV39882 UniProt:  A0A347ALN5 LinkDB All DBs Position complement(1244552..1244773) Genome browser AA seq 73 aa AA seqDB search MITVNENLCKGCNICTEFCPRKVYGKSGKLNKKGVNVPVPENEDKCTQCQLCAMMCPDQA IKVDEKVDDADEN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgataaccgttaatgagaatctgtgcaaaggctgtaacatctgcaccgagttctgtccc cgtaaagtttatgggaaatcagggaagctcaataagaagggtgtgaatgttccagtacct gaaaatgaggacaagtgcacccagtgtcagctgtgtgccatgatgtgtcctgatcaggca ataaaagtagatgaaaaagtggatgatgcggatgaaaactga

DBGET integrated database retrieval system