Methanobrevibacter sp. TLL-48-HuF1: K4897_06835 Help Entry K4897_06835       CDS       T08254                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism metv  Methanobrevibacter sp. TLL-48-HuF1 Pathway metv00020   Citrate cycle (TCA cycle) metv00720   Carbon fixation pathways in prokaryotes metv01100   Metabolic pathways metv01110   Biosynthesis of secondary metabolites metv01120   Microbial metabolism in diverse environments metv01200   Carbon metabolism metv01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:metv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     K4897_06835   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     K4897_06835 Enzymes [BR:metv01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      K4897_06835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_9 Fer4_2 Fer4_10 Fer4_21 Fer4_16 Fer4_4 Fer4_3 Fer4_13 Fer4_17 ETF_QO Fer4_8 Fer4_15 Motif Other DBs NCBI-ProteinID:  URN49012 UniProt:  A0A9E7IMQ7 LinkDB All DBs Position 1456596..1456805 Genome browser AA seq 69 aa AA seqDB search MIIIDENLCKGCHLCLYMCPQNVYAISSEPNKKSVQLPYVNFGDRCDKCGKCEIACPDQA ITVNDLEGK NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgattattattgacgaaaatttatgcaaagggtgtcacctttgtctatatatgtgtcca cagaatgtttacgcaatatcttctgaacctaataaaaaaagcgtacaattgccgtatgtt aattttggagataggtgtgataaatgtggtaaatgtgaaatagcttgccctgatcaagct atcacagtaaatgatttagagggtaaatag

DBGET integrated database retrieval system