Phytobacter sp. MRY16-398: MRY16398_07210 Help Entry MRY16398_07210    CDS       T05735                                  Symbol ygiG Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism mety  Phytobacter sp. MRY16-398 Pathway mety00790   Folate biosynthesis mety01100   Metabolic pathways mety01240   Biosynthesis of cofactors Module mety_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:mety00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     MRY16398_07210 (ygiG) Enzymes [BR:mety01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      MRY16398_07210 (ygiG)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      MRY16398_07210 (ygiG)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      MRY16398_07210 (ygiG) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DUF2866 Motif Other DBs NCBI-ProteinID:  BBE75665 UniProt:  A0A348D848 LinkDB All DBs Position 757093..757464 Genome browser AA seq 123 aa AA seqDB search MMDIVFIEQLSVITTIGVYDWEQTIEQKLVFDIEMAWDNRQAAKSDDVNDCLSYADIAET VIAHVEGSRFALVERVAEEVADLLLSRFNSPWVRIKLSKPGAVARAANVGVIIERGNNLK KII NT seq 372 nt NT seq  +upstreamnt  +downstreamnt gtgatggacattgtatttatagagcaactttcggtaatcaccactatcggtgtgtatgac tgggagcagacgattgagcaaaagctggtgttcgatatcgaaatggcatgggataaccgc caggcggcaaagagcgacgatgttaatgattgtctgagctatgcagacatagcagaaacc gtgattgcgcatgtcgaaggaagccgttttgcgctggtggaacgggtcgccgaagaggtc gctgatttactgctgagccgttttaactctccatgggtgcgcatcaaattgagcaagcca ggggctgtcgcccgggccgccaacgttggcgtcatcattgagcgtggcaataatctgaaa aaaattatttaa

DBGET integrated database retrieval system