Methylophilus sp. TWE2: ACJ67_12930 Help Entry ACJ67_12930       CDS       T04002                                  Name (GenBank) dienelactone hydrolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism meu  Methylophilus sp. TWE2 Pathway meu00790   Folate biosynthesis meu01100   Metabolic pathways meu01240   Biosynthesis of cofactors Module meu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:meu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ACJ67_12930 Enzymes [BR:meu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ACJ67_12930  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ACJ67_12930  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ACJ67_12930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AKR44212 UniProt:  A0A0K0SY05 LinkDB All DBs Position 2743376..2743729 Genome browser AA seq 117 aa AA seqDB search MDTIFLEQVKVQTKLGVPEWERTLPQTVILDIEIGYDFSKACQSDAIENTIDYGLVVARI RETLAEHSFKLVEALGEHVCQLILKEFKAQNVKLKVSKPGILPGLKALGVVMERDQK NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggacacaatttttctcgaacaagtcaaagtgcaaaccaaactgggcgtgccggaatgg gaacgcaccctcccgcaaactgtgatcctggatattgaaattggctatgatttcagtaaa gcctgccaaagtgatgcgattgaaaatacgatagattacggccttgtagtcgcgcgcata cgggagacattagccgagcatagtttcaagcttgttgaggccttgggtgagcatgtttgc caactcattttgaaagaatttaaggcgcagaatgtgaaattgaaagtgagtaagccgggg atattgccggggttaaaagcattgggggtggtgatggagagagatcaaaaatga

DBGET integrated database retrieval system