Methanobrevibacter sp. YE315: TL18_02115 Help Entry TL18_02115        CDS       T04279                                  Name (GenBank) pyruvate synthase   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism meye  Methanobrevibacter sp. YE315 Pathway meye00010   Glycolysis / Gluconeogenesis meye00020   Citrate cycle (TCA cycle) meye00620   Pyruvate metabolism meye00633   Nitrotoluene degradation meye00640   Propanoate metabolism meye00650   Butanoate metabolism meye00680   Methane metabolism meye00720   Carbon fixation pathways in prokaryotes meye01100   Metabolic pathways meye01110   Biosynthesis of secondary metabolites meye01120   Microbial metabolism in diverse environments meye01200   Carbon metabolism meye01210   2-Oxocarboxylic acid metabolism Module meye_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:meye00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     TL18_02115    00020 Citrate cycle (TCA cycle)     TL18_02115    00620 Pyruvate metabolism     TL18_02115    00640 Propanoate metabolism     TL18_02115    00650 Butanoate metabolism     TL18_02115   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     TL18_02115    00680 Methane metabolism     TL18_02115   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     TL18_02115 Enzymes [BR:meye01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      TL18_02115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_6 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_13 Fer4_22 Fer4_8 Fer4_15 Fer4_17 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  AMD18423 UniProt:  A0A109UVN1 LinkDB All DBs Position complement(480077..480319) Genome browser AA seq 80 aa AA seqDB search MVSIGCVIKTPGNSRNNKTGSWRTFKPILDKEKCIDCDNCIIFCPDSSINKQHDIDYDYC KGCGICANECPSDAIEMVKE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggtaagtataggatgtgtaattaaaacaccgggtaacagtagaaacaataaaactgga agctggagaacatttaaaccaattttagacaaagaaaaatgtattgattgtgataattgt attatcttctgtcctgattccagtataaacaaacaacatgatattgattacgattactgt aaaggatgcggaatttgtgcaaacgaatgtccttccgatgcaatcgaaatggtaaaagaa tag

DBGET integrated database retrieval system