Methanobacterium ferruginis: GCM10025860_10350 Help Entry GCM10025860_10350 CDS       T09214                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mfeg  Methanobacterium ferruginis Pathway mfeg00020   Citrate cycle (TCA cycle) mfeg00720   Carbon fixation pathways in prokaryotes mfeg01100   Metabolic pathways mfeg01110   Biosynthesis of secondary metabolites mfeg01120   Microbial metabolism in diverse environments mfeg01200   Carbon metabolism mfeg01210   2-Oxocarboxylic acid metabolism Module mfeg_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mfeg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     GCM10025860_10350   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     GCM10025860_10350 Enzymes [BR:mfeg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      GCM10025860_10350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_10 Fer4_2 Fer4_21 Fer4_16 Fer4_9 Fer4_4 Fer4_8 Fer4_13 Fer4_15 Fer4_22 Fer4_3 Fer4_17 ETF_QO Fer4_18 Motif Other DBs NCBI-ProteinID:  BDZ67587 LinkDB All DBs Position 983676..983897 Genome browser AA seq 73 aa AA seqDB search MITVDENLCKGCNICTEFCPRKVYQESGILNKKGVHVPVPENEDKCTQCQLCVMMCPDQA IKVDEKVDEKDDK NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgataaccgttgatgaaaatctgtgtaaaggctgtaacatctgcactgagttctgccct cgtaaggtttaccaggaatcaggaatccttaacaaaaagggtgtgcatgttccagtaccg gaaaatgaggacaaatgcactcaatgccagttatgtgtaatgatgtgtcctgatcaagca ataaaagtagatgaaaaagtggatgagaaggatgacaagtga

DBGET integrated database retrieval system