Micromonospora ferruginea: H1D33_18995 Help Entry H1D33_18995       CDS       T09299                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mfeu  Micromonospora ferruginea Pathway mfeu00261   Monobactam biosynthesis mfeu01100   Metabolic pathways mfeu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mfeu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H1D33_18995  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mfeu01008]     H1D33_18995 Polyketide biosynthesis proteins [BR:mfeu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H1D33_18995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QLQ35470 UniProt:  A0A7L6B1G4 LinkDB All DBs Position complement(2812802..2812990) Genome browser AA seq 62 aa AA seqDB search MAEPRFLVVRNDEEQYSIWSADRELPAGWQDTGFAGSREECLAHVDEVWTDMRPRSVREA LS NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggccgaaccccgattcctggtcgtccgcaacgacgaggagcagtactcgatctggtcg gccgaccgggagctgcccgccggctggcaggacaccggtttcgccggcagccgcgaggag tgcctggcccacgtggacgaggtgtggaccgacatgcgcccgcgctcggtacgcgaggcg ctctcatga

DBGET integrated database retrieval system