Micromonospora ferruginea: H1D33_25055 Help Entry H1D33_25055       CDS       T09299                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mfeu  Micromonospora ferruginea Pathway mfeu00261   Monobactam biosynthesis mfeu01100   Metabolic pathways mfeu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mfeu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H1D33_25055  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mfeu01008]     H1D33_25055 Polyketide biosynthesis proteins [BR:mfeu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H1D33_25055 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF3256 Motif Other DBs NCBI-ProteinID:  QLQ40524 UniProt:  A0A7L6BF14 LinkDB All DBs Position 1299176..1299397 Genome browser AA seq 73 aa AA seqDB search MPMNPFENPDGRYLVLVNDEGQHSLWPVFAEVPDGWTTVFGEDGRQECLDYIEKNWTDLR PKSLIRALEESRA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt attccgatgaatccgttcgagaaccccgacggccgttatctcgtcctcgtcaacgacgag gggcagcattcactctggccggtattcgccgaggtgcccgacgggtggaccaccgtgttc ggcgaggacggccggcaggaatgcctcgactacatcgagaagaactggacggatctgcgg ccgaaaagcctgatccgggccctggaggagagccgggcctga

DBGET integrated database retrieval system