Methanoregula formicica: Metfor_2323 Help Entry Metfor_2323       CDS       T02392                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mfo  Methanoregula formicica Pathway mfo00020   Citrate cycle (TCA cycle) mfo00720   Carbon fixation pathways in prokaryotes mfo01100   Metabolic pathways mfo01110   Biosynthesis of secondary metabolites mfo01120   Microbial metabolism in diverse environments mfo01200   Carbon metabolism mfo01210   2-Oxocarboxylic acid metabolism Module mfo_M00620   Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate Brite KEGG Orthology (KO) [BR:mfo00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Metfor_2323   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     Metfor_2323 Enzymes [BR:mfo01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Metfor_2323 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_4 Fer4_16 Fer4_3 Fer4_8 Fer4_15 Fer4_11 Fer4_22 Fer4_13 Motif Other DBs NCBI-ProteinID:  AGB03327 UniProt:  L0HF20 LinkDB All DBs Position complement(2288609..2288881) Genome browser AA seq 90 aa AA seqDB search MKLAIDENRCKGCNLCTKVCPYKIFREGKKLNRKGVAVPELDRPERCTNCRLRNLYGRQL CGVCQLTCPDQAIHWVEEEPYEPHKVAIEY NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaagctcgccatcgacgagaaccggtgcaagggatgcaacctctgcacgaaagtctgc ccgtataagatcttccgggagggaaagaagctgaaccgcaaaggggttgccgttcccgag ctggaccgtcccgagcgctgcaccaactgccggctccgcaacctttatggccggcagctc tgcggggtctgccagctcacctgccccgaccaggcaatccactgggtcgaggaagaaccg tacgaaccccacaaggtggcgattgaatattga

DBGET integrated database retrieval system