Marinomonas foliarum: JSY38_03015 Help Entry JSY38_03015       CDS       T07165                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mfoi  Marinomonas foliarum Pathway mfoi00261   Monobactam biosynthesis mfoi01100   Metabolic pathways mfoi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mfoi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     JSY38_03015  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mfoi01008]     JSY38_03015 Polyketide biosynthesis proteins [BR:mfoi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     JSY38_03015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QRV24521 LinkDB All DBs Position complement(645198..645422) Genome browser AA seq 74 aa AA seqDB search MSNEVINPFDDDSLAFLVLVNALQQHSLWPLFKAIPPGWRQAFGPSSRENCLEYVETNWT DIRPQHSPSLSSGS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagtaatgaagtaattaacccatttgacgatgattcattggcgtttttggtcttagta aatgcactgcagcagcacagtttgtggccactttttaaggcaataccaccaggttggcga caggcttttggcccgagttctcgtgaaaattgtcttgagtatgtcgaaacgaattggacg gatattcgcccccaacattccccttcactttctagcggttcttaa

DBGET integrated database retrieval system