Malassezia globosa: MGL_3267 Help Entry MGL_3267          CDS       T01043                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism mgl  Malassezia globosa Pathway mgl03020   RNA polymerase mgl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mgl00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MGL_3267   09124 Replication and repair    03420 Nucleotide excision repair     MGL_3267  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mgl03021]     MGL_3267    03400 DNA repair and recombination proteins [BR:mgl03400]     MGL_3267 Transcription machinery [BR:mgl03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MGL_3267   RNA polymerase III system    RNA polymerase III      MGL_3267   RNA polymerase I system    RNA polymerase I      MGL_3267 DNA repair and recombination proteins [BR:mgl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MGL_3267 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 Motif Other DBs NCBI-GeneID:  5854029 NCBI-ProteinID:  XP_001729723 UniProt:  A8Q8G6 LinkDB All DBs AA seq 147 aa AA seqDB search MSTNSLFDTQFVVKDIDPDGKKFDRVSRVIASSPTLDMTLSLDIATDIYPVHVGQQLAFL LVSSLRRDKAESDATADRDAWRLDQDDNSLAKGFDYVMYGKIFKYDERSTEQVTVYGSFG GLLMALTGSFRHLSKITVGSNVYLLMR NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgagtacgaatagcctgtttgatacgcagtttgtggtgaaagacattgatccagatgga aagaaatttgatcgcgtgtcgcgggttatcgcatcgtcacccacacttgacatgacgttg tccctcgacatcgcgacggacatttaccctgttcatgttgggcaacagcttgcttttctg ctagtgtcatcgctccgacgtgacaaggcagagagtgatgccacagccgatcgtgatgcg tggcgtcttgatcaggacgacaattcactcgcgaagggctttgactatgtcatgtacggc aagatctttaaatatgacgagcgcagcacggagcaggtgacggtgtacggttcatttggt gggctcctgatggcactgacgggctcttttcgccatttgagcaagatcaccgttggttcg aacgtgtatttgctcatgcgctaa

DBGET integrated database retrieval system