Malassezia globosa: MGL_3424 Help Entry MGL_3424          CDS       T01043                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism mgl  Malassezia globosa Pathway mgl03020   RNA polymerase mgl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mgl00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MGL_3424   09124 Replication and repair    03420 Nucleotide excision repair     MGL_3424  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mgl03021]     MGL_3424    03400 DNA repair and recombination proteins [BR:mgl03400]     MGL_3424 Transcription machinery [BR:mgl03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MGL_3424   RNA polymerase III system    RNA polymerase III      MGL_3424   RNA polymerase I system    RNA polymerase I      MGL_3424 DNA repair and recombination proteins [BR:mgl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MGL_3424 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  5853696 NCBI-ProteinID:  XP_001729389 UniProt:  A8Q970 LinkDB All DBs AA seq 146 aa AA seqDB search MSFEAGDENEADYFDEGVDFDAAEMDEPLNEEAGAGDDEDHFGDNEVVHSSADGNIPMNM DTSGKANSERITTPYMTKYEKARILGTRALQISMNAPVLVPTEGEMDPLAIAQKELLAKK IPLLVRRYLPDGTFEDWSVSELIITD NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgagttttgaagcgggtgacgaaaatgaagccgactattttgacgagggagttgatttc gatgcggcagagatggacgagccattgaacgaagaggcaggcgctggagatgatgaagat cactttggcgacaatgaagtggtgcattctagtgccgacggcaatattcccatgaatatg gatacgtcaggaaaagctaattcggagcggatcacgacaccgtatatgaccaaatatgaa aaagcgcgtattttgggtacgcgtgcgctgcaaatcagtatgaacgcaccagttctagtg cctacagaaggagagatggatccgttagctattgcacagaaagagcttttggccaaaaag attcctcttctcgtgcggcggtacctaccagatggtacttttgaggactggagtgtgtcc gaactcattatcacggattaa

DBGET integrated database retrieval system