Mycobacterium vicinigordonae: H0P51_18660 Help Entry H0P51_18660       CDS       T06936                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mgor  Mycobacterium vicinigordonae Pathway mgor00261   Monobactam biosynthesis mgor01100   Metabolic pathways mgor01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mgor00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H0P51_18660  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mgor01008]     H0P51_18660 Polyketide biosynthesis proteins [BR:mgor01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H0P51_18660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QLL05823 UniProt:  A0A7D6E367 LinkDB All DBs Position complement(4157987..4158202) Genome browser AA seq 71 aa AA seqDB search MSINPFDDDDGMFYVLTNDEEQHSLWPAYIDRPSGWWVVFGADSRPNCLAYVEQSWTDMR PKSLRDAMAAV NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagtatcaatccgtttgatgacgacgacggcatgttctatgtcttgaccaacgacgag gaacagcacagcctttggccggcgtacatcgatcggccgtccggctggtgggttgtcttc ggcgctgacagccgacccaactgtctggcgtatgtcgagcagtcctggacggatatgcgg cccaaaagccttcgcgacgcgatggctgccgtctga

DBGET integrated database retrieval system