Mycolicibacterium grossiae: FZ046_23090 Help Entry FZ046_23090       CDS       T06593                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mgro  Mycolicibacterium grossiae Pathway mgro00261   Monobactam biosynthesis mgro01100   Metabolic pathways mgro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mgro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FZ046_23090  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mgro01008]     FZ046_23090 Polyketide biosynthesis proteins [BR:mgro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FZ046_23090 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEM47272 LinkDB All DBs Position complement(4798931..4799143) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDEDGTFYVLVNDEEQHSLWPTFAEVPAGWRIVFGESTRADCLAYVEEHWTDLR PRSLREAMAD NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaatccgttcgatgacgaggacggcaccttctacgtcctggtgaacgacgag gagcagcacagcctgtggccgacgttcgccgaggtgccggccggctggcgcatcgtgttc ggcgagagcacgcgcgccgactgcctggcctacgtcgaggagcactggaccgacctgcgg ccgaggagcctgcgcgaggcgatggccgactga

DBGET integrated database retrieval system