Micromonospora halotolerans: RMN56_32150 Help Entry RMN56_32150       CDS       T09415                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism mhaw  Micromonospora halotolerans Pathway mhaw00261   Monobactam biosynthesis mhaw01100   Metabolic pathways mhaw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mhaw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RMN56_32150  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mhaw01008]     RMN56_32150 Polyketide biosynthesis proteins [BR:mhaw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RMN56_32150 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WNM39700 LinkDB All DBs Position complement(6850280..6850468) Genome browser AA seq 62 aa AA seqDB search MAEPRFLVVRNDEEQYSIWSADRDLPAGWHDTGFAGTREECLAHVDEVWTDMRPRSVREA SQ NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atggccgaaccccgattcctggtcgtccgcaacgacgaggagcagtactcgatctggtcg gccgaccgggacctccccgcgggctggcacgacaccggcttcgccggcacccgcgaggag tgcctggcccacgtcgacgaggtctggaccgacatgcgtccccgctccgtccgcgaggcc agtcagtga

DBGET integrated database retrieval system