Methanohalophilus halophilus: BHR79_01745 Help Entry BHR79_01745       CDS       T04572                                  Name (GenBank) pyruvate synthase   KO K00171   pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1] Organism mhaz  Methanohalophilus halophilus Pathway mhaz00010   Glycolysis / Gluconeogenesis mhaz00020   Citrate cycle (TCA cycle) mhaz00620   Pyruvate metabolism mhaz00640   Propanoate metabolism mhaz00650   Butanoate metabolism mhaz00680   Methane metabolism mhaz00720   Carbon fixation pathways in prokaryotes mhaz01100   Metabolic pathways mhaz01110   Biosynthesis of secondary metabolites mhaz01120   Microbial metabolism in diverse environments mhaz01200   Carbon metabolism mhaz01210   2-Oxocarboxylic acid metabolism Module mhaz_M00307   Pyruvate oxidation, pyruvate => acetyl-CoA Brite KEGG Orthology (KO) [BR:mhaz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00010 Glycolysis / Gluconeogenesis     BHR79_01745    00020 Citrate cycle (TCA cycle)     BHR79_01745    00620 Pyruvate metabolism     BHR79_01745    00640 Propanoate metabolism     BHR79_01745    00650 Butanoate metabolism     BHR79_01745   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     BHR79_01745    00680 Methane metabolism     BHR79_01745   09111 Xenobiotics biodegradation and metabolism    00633 Nitrotoluene degradation     BHR79_01745 Enzymes [BR:mhaz01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.1  pyruvate synthase      BHR79_01745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_21 Fer4_7 Fer4_9 Fer4_10 Fer4_4 Fer4_16 Fer4_17 Fer4_15 Fer4_8 Fer4_13 Fer4_22 Fer4_3 Motif Other DBs NCBI-ProteinID:  APH38333 UniProt:  A0A1L3Q0F0 LinkDB All DBs Position complement(353028..353288) Genome browser AA seq 86 aa AA seqDB search MSISLGGVCEPGTTRVNKTGGWRTFRPVFDYDKCIKCKLCELLCPDMAVFPRDDGFFEFD YDYCKGCGICANECPTEAIDMVLEEK NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcatatcacttggaggagtctgtgaacccggtaccacgagggtaaacaagaccggt ggctggagaaccttcagaccagtctttgattatgacaaatgtattaagtgcaaattatgt gaactgctctgtcctgacatggcggtgtttcccagggatgacggattctttgaatttgac tatgattactgcaaaggttgcggaatctgtgccaatgaatgtcccacagaagccatcgat atggtattggaggaaaaataa

DBGET integrated database retrieval system